NDC80 purified MaxPab rabbit polyclonal antibody (D01P)
  • NDC80 purified MaxPab rabbit polyclonal antibody (D01P)

NDC80 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010403-D01P
NDC80 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NDC80 protein.
Información adicional
Size 100 ug
Gene Name NDC80
Gene Alias HEC|HEC1|KNTC2|TID3|hsNDC80
Gene Description NDC80 homolog, kinetochore complex component (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKRSSVSSGGAGRLSMQELRSQDVNKQGLYTPQTKEKPTFGKLSINKPTSERKVSLFGKRTSGHGSRNSQLGIFSSSEKIKDPRPLNDKAFIQQCIRQLCEFLTENGYAHNVSMKSLQAPSVKDFLKIFTFLYGFLCPSYELPDTKFEEEVPRIFKDLGYPFALSKSSMYTVGAPHTWPHIVAALVWLIDCIKIHTAMKESSPLFDDGQPWGEETEDGIMHNKLFLDYTIKCYESFMSGADSFDEMNAELQSKLK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NDC80 (NP_006092.1, 1 a.a. ~ 642 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10403

Enviar un mensaje


NDC80 purified MaxPab rabbit polyclonal antibody (D01P)

NDC80 purified MaxPab rabbit polyclonal antibody (D01P)