DLC1 purified MaxPab mouse polyclonal antibody (B01P)
  • DLC1 purified MaxPab mouse polyclonal antibody (B01P)

DLC1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010395-B01P
DLC1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human DLC1 protein.
Información adicional
Size 50 ug
Gene Name DLC1
Gene Alias ARHGAP7|FLJ21120|HP|STARD12|p122-RhoGAP
Gene Description deleted in liver cancer 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSVAIRKRSWEEHVTHWMGQPFNSDDRNTACHHGLVADSLQASMEKDATLNVDRKEKCVSLPDCCHGSELRDFPGRPMGHLSKDVDENDSHEGEDQFLSLEASTETLVHVSDEDNNADLCLTDDKQVLNTQGQKTSGQHMIQGAGSLEKALPIIQSNQVSSNSWGIAGETELALVKESGERKVTDSISKSLELCNEISLSEIKDAPKVNAVDTLNVKDIAPEKQLLNSAVIAQQRRKPDPPKDENERSTCNVVQD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DLC1 (NP_872584.1, 1 a.a. ~ 1528 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10395

Enviar un mensaje


DLC1 purified MaxPab mouse polyclonal antibody (B01P)

DLC1 purified MaxPab mouse polyclonal antibody (B01P)