ANAPC10 purified MaxPab rabbit polyclonal antibody (D01P)
  • ANAPC10 purified MaxPab rabbit polyclonal antibody (D01P)

ANAPC10 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010393-D01P
ANAPC10 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ANAPC10 protein.
Información adicional
Size 100 ug
Gene Name ANAPC10
Gene Alias APC10|DKFZp564L0562|DOC1
Gene Description anaphase promoting complex subunit 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ANAPC10 (AAH05217.1, 1 a.a. ~ 185 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10393

Enviar un mensaje


ANAPC10 purified MaxPab rabbit polyclonal antibody (D01P)

ANAPC10 purified MaxPab rabbit polyclonal antibody (D01P)