CARD4 polyclonal antibody (A01)
  • CARD4 polyclonal antibody (A01)

CARD4 polyclonal antibody (A01)

Ref: AB-H00010392-A01
CARD4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CARD4.
Información adicional
Size 50 uL
Gene Name NOD1
Gene Alias CARD4|CLR7.1|NLRC1
Gene Description nucleotide-binding oligomerization domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MEEQGHSEMEIIPSESHPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVCACPTQPDKVRKILDLVQSKGEEVSEFFLYLLQQL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CARD4 (AAH40339, 1 a.a. ~ 93 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10392

Enviar un mensaje


CARD4 polyclonal antibody (A01)

CARD4 polyclonal antibody (A01)