TUBA1B purified MaxPab rabbit polyclonal antibody (D01P)
  • TUBA1B purified MaxPab rabbit polyclonal antibody (D01P)

TUBA1B purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010376-D01P
TUBA1B purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TUBA1B protein.
Información adicional
Size 100 ug
Gene Name TUBA1B
Gene Alias K-ALPHA-1
Gene Description tubulin, alpha 1b
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TUBA1B (NP_006073.2, 1 a.a. ~ 451 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10376

Enviar un mensaje


TUBA1B purified MaxPab rabbit polyclonal antibody (D01P)

TUBA1B purified MaxPab rabbit polyclonal antibody (D01P)