TUBA1B polyclonal antibody (A01)
  • TUBA1B polyclonal antibody (A01)

TUBA1B polyclonal antibody (A01)

Ref: AB-H00010376-A01
TUBA1B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant TUBA1B.
Información adicional
Size 50 uL
Gene Name TUBA1B
Gene Alias K-ALPHA-1
Gene Description tubulin, alpha 1b
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MRECISIHVGQAGVQIGNACWELYCLKHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TUBA1B (AAH08659, 1 a.a. ~ 451 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10376

Enviar un mensaje


TUBA1B polyclonal antibody (A01)

TUBA1B polyclonal antibody (A01)