SEMA3A polyclonal antibody (A01)
  • SEMA3A polyclonal antibody (A01)

SEMA3A polyclonal antibody (A01)

Ref: AB-H00010371-A01
SEMA3A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SEMA3A.
Información adicional
Size 50 uL
Gene Name SEMA3A
Gene Alias Hsema-I|Hsema-III|MGC133243|SEMA1|SEMAD|SEMAIII|SEMAL|SemD|coll-1
Gene Description sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq HLEELLHKDDDGDGSKTKEMSNSMTPSQKVWYRDFMQLINHPNLNTMDEFCEQVWKRDRKQRRQRPGHTPGNSNKWKHLQENKKGRNRRTHEFERAPRS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SEMA3A (NP_006071, 672 a.a. ~ 770 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10371

Enviar un mensaje


SEMA3A polyclonal antibody (A01)

SEMA3A polyclonal antibody (A01)