CBARA1 polyclonal antibody (A01) Ver mas grande

CBARA1 polyclonal antibody (A01)

AB-H00010367-A01

Producto nuevo

CBARA1 polyclonal antibody (A01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 50 uL
Gene Name CBARA1
Gene Alias CALC|DKFZp564C246|EFHA3|FLJ12684
Gene Description calcium binding atopy-related autoantigen 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLMQAMWKCAQETAWDFALPKQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CBARA1 (NP_006068, 380 a.a. ~ 478 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10367

Más información

Mouse polyclonal antibody raised against a partial recombinant CBARA1.

Consulta sobre un producto

CBARA1 polyclonal antibody (A01)

CBARA1 polyclonal antibody (A01)