KLF2 polyclonal antibody (A01)
  • KLF2 polyclonal antibody (A01)

KLF2 polyclonal antibody (A01)

Ref: AB-H00010365-A01
KLF2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KLF2.
Información adicional
Size 50 uL
Gene Name KLF2
Gene Alias LKLF
Gene Description Kruppel-like factor 2 (lung)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILSMGLDGL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLF2 (NP_057354, 1 a.a. ~ 56 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10365

Enviar un mensaje


KLF2 polyclonal antibody (A01)

KLF2 polyclonal antibody (A01)