CCL26 purified MaxPab mouse polyclonal antibody (B01P)
  • CCL26 purified MaxPab mouse polyclonal antibody (B01P)

CCL26 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010344-B01P
CCL26 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CCL26 protein.
Información adicional
Size 50 ug
Gene Name CCL26
Gene Alias IMAC|MGC126714|MIP-4a|MIP-4alpha|SCYA26|TSC-1
Gene Description chemokine (C-C motif) ligand 26
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MMGLSLASAVLLASLLSLHLGTATRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CCL26 (NP_006063.1, 1 a.a. ~ 94 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10344

Enviar un mensaje


CCL26 purified MaxPab mouse polyclonal antibody (B01P)

CCL26 purified MaxPab mouse polyclonal antibody (B01P)