TFG purified MaxPab mouse polyclonal antibody (B01P)
  • TFG purified MaxPab mouse polyclonal antibody (B01P)

TFG purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010342-B01P
TFG purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TFG protein.
Información adicional
Size 50 ug
Gene Name TFG
Gene Alias FLJ36137|TF6|TRKT3
Gene Description TRK-fused gene
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPSAPAEDRSGTPDSIASSSSAAHPPGVQPQQPPYTGAQTQAGQIEGQMYQQYQQQAGYGA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TFG (AAH09241, 1 a.a. ~ 400 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10342

Enviar un mensaje


TFG purified MaxPab mouse polyclonal antibody (B01P)

TFG purified MaxPab mouse polyclonal antibody (B01P)