TFG polyclonal antibody (A01)
  • TFG polyclonal antibody (A01)

TFG polyclonal antibody (A01)

Ref: AB-H00010342-A01
TFG polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TFG.
Información adicional
Size 50 uL
Gene Name TFG
Gene Alias FLJ36137|TF6|TRKT3
Gene Description TRK-fused gene
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TFG (NP_006061, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10342

Enviar un mensaje


TFG polyclonal antibody (A01)

TFG polyclonal antibody (A01)