PCGF3 monoclonal antibody (M03), clone 1F1
  • PCGF3 monoclonal antibody (M03), clone 1F1

PCGF3 monoclonal antibody (M03), clone 1F1

Ref: AB-H00010336-M03
PCGF3 monoclonal antibody (M03), clone 1F1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCGF3.
Información adicional
Size 100 ug
Gene Name PCGF3
Gene Alias DKFZp686D20235|DONG1|FLJ36550|FLJ43813|MGC129615|MGC40413|RNF3|RNF3A
Gene Description polycomb group ring finger 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq SNKEAAEEKPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFIAKKLNLSSFNELDILCNEEILGKDHTLKFVVVTRWRFKKAPLLLHYRPKMDLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCGF3 (NP_006306, 133 a.a. ~ 242 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10336
Clone Number 1F1
Iso type IgG2a Kappa

Enviar un mensaje


PCGF3 monoclonal antibody (M03), clone 1F1

PCGF3 monoclonal antibody (M03), clone 1F1