TLR6 monoclonal antibody (M04), clone 1H4
  • TLR6 monoclonal antibody (M04), clone 1H4

TLR6 monoclonal antibody (M04), clone 1H4

Ref: AB-H00010333-M04
TLR6 monoclonal antibody (M04), clone 1H4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TLR6.
Información adicional
Size 100 ug
Gene Name TLR6
Gene Alias CD286
Gene Description toll-like receptor 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq LVFHPTSLFAIQVNISVNTLGCLQLTNIKLNDDNCQVFIKFLSELTRGSTLLNFTLNHIETTWKCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TLR6 (NP_006059, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10333
Clone Number 1H4
Iso type IgG2a Kappa

Enviar un mensaje


TLR6 monoclonal antibody (M04), clone 1H4

TLR6 monoclonal antibody (M04), clone 1H4