COX4NB purified MaxPab mouse polyclonal antibody (B01P)
  • COX4NB purified MaxPab mouse polyclonal antibody (B01P)

COX4NB purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010328-B01P
COX4NB purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human COX4NB protein.
Información adicional
Size 50 ug
Gene Name COX4NB
Gene Alias C16orf2|C16orf4|FAM158B|NOC4
Gene Description COX4 neighbor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen COX4NB (NP_006058.1, 1 a.a. ~ 210 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10328

Enviar un mensaje


COX4NB purified MaxPab mouse polyclonal antibody (B01P)

COX4NB purified MaxPab mouse polyclonal antibody (B01P)