Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
AKR1A1 purified MaxPab rabbit polyclonal antibody (D01P)
Abnova
AKR1A1 purified MaxPab rabbit polyclonal antibody (D01P)
Ref: AB-H00010327-D01P
AKR1A1 purified MaxPab rabbit polyclonal antibody (D01P)
Contáctenos
Información del producto
Rabbit polyclonal antibody raised against a full-length human AKR1A1 protein.
Información adicional
Size
100 ug
Gene Name
AKR1A1
Gene Alias
ALDR1|ALR|ARM|DD3|MGC12529|MGC1380
Gene Description
aldo-keto reductase family 1, member A1 (aldehyde reductase)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ti,WB-Tr
Immunogen Prot. Seq
MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTICYDSTHYKETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPDEPVLLEEPVVLALAEKYGRSPAQILLRWQVQ
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
AKR1A1 (NP_006057.1, 1 a.a. ~ 325 a.a) full-length human protein.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
10327
Enviar un mensaje
AKR1A1 purified MaxPab rabbit polyclonal antibody (D01P)
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*