SIRPB1 MaxPab mouse polyclonal antibody (B01P)
  • SIRPB1 MaxPab mouse polyclonal antibody (B01P)

SIRPB1 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010326-B01P
SIRPB1 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SIRPB1 protein.
Información adicional
Size 50 ug
Gene Name SIRPB1
Gene Alias CD172b|DKFZp686A05192|FLJ26614|SIRP-BETA-1
Gene Description signal-regulatory protein beta 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAAGESATLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVREPALAPTAPLLVALLLGPKLLLVVGVSAIYICWKQKA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SIRPB1 (AAH75835.1, 1 a.a. ~ 181 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10326

Enviar un mensaje


SIRPB1 MaxPab mouse polyclonal antibody (B01P)

SIRPB1 MaxPab mouse polyclonal antibody (B01P)