NMUR1 polyclonal antibody (A01)
  • NMUR1 polyclonal antibody (A01)

NMUR1 polyclonal antibody (A01)

Ref: AB-H00010316-A01
NMUR1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NMUR1.
Información adicional
Size 50 uL
Gene Name NMUR1
Gene Alias (FM-3)|FM-3|FM3|GPC-R|GPR66|NMU1R
Gene Description neuromedin U receptor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TPLCLNCSVLPGDLYPGGARNPMACNGSAARGHFDPEDLNLTDEALRLKYLGPQQTELFMPICATYL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NMUR1 (NP_006047, 2 a.a. ~ 68 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10316

Enviar un mensaje


NMUR1 polyclonal antibody (A01)

NMUR1 polyclonal antibody (A01)