LANCL1 monoclonal antibody (M01), clone 9A12
  • LANCL1 monoclonal antibody (M01), clone 9A12

LANCL1 monoclonal antibody (M01), clone 9A12

Ref: AB-H00010314-M01
LANCL1 monoclonal antibody (M01), clone 9A12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LANCL1.
Información adicional
Size 100 ug
Gene Name LANCL1
Gene Alias GPR69A|p40
Gene Description LanC lantibiotic synthetase component C-like 1 (bacterial)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LANCL1 (NP_006046, 1 a.a. ~ 58 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10314
Clone Number 9A12
Iso type IgG2a Kappa

Enviar un mensaje


LANCL1 monoclonal antibody (M01), clone 9A12

LANCL1 monoclonal antibody (M01), clone 9A12