TCIRG1 monoclonal antibody (M02A), clone 7H20
  • TCIRG1 monoclonal antibody (M02A), clone 7H20

TCIRG1 monoclonal antibody (M02A), clone 7H20

Ref: AB-H00010312-M02A
TCIRG1 monoclonal antibody (M02A), clone 7H20

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TCIRG1.
Información adicional
Size 200 uL
Gene Name TCIRG1
Gene Alias ATP6N1C|ATP6V0A3|Atp6i|OC-116kDa|OC116|OPTB1|Stv1|TIRC7|Vph1|a3
Gene Description T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QLHQLQLHAAVLRQGHEPQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAPALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TCIRG1 (AAH18133, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 10312
Clone Number 7H20
Iso type IgG1 Kappa

Enviar un mensaje


TCIRG1 monoclonal antibody (M02A), clone 7H20

TCIRG1 monoclonal antibody (M02A), clone 7H20