TCIRG1 monoclonal antibody (M01), clone 6H3
  • TCIRG1 monoclonal antibody (M01), clone 6H3

TCIRG1 monoclonal antibody (M01), clone 6H3

Ref: AB-H00010312-M01
TCIRG1 monoclonal antibody (M01), clone 6H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TCIRG1.
Información adicional
Size 100 ug
Gene Name TCIRG1
Gene Alias ATP6N1C|ATP6V0A3|Atp6i|OC-116kDa|OC116|OPTB1|Stv1|TIRC7|Vph1|a3
Gene Description T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QLHQLQLHAAVLRQGHEPQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAPALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TCIRG1 (AAH18133, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10312
Clone Number 6H3
Iso type IgG2a Kappa

Enviar un mensaje


TCIRG1 monoclonal antibody (M01), clone 6H3

TCIRG1 monoclonal antibody (M01), clone 6H3