TCIRG1 polyclonal antibody (A01)
  • TCIRG1 polyclonal antibody (A01)

TCIRG1 polyclonal antibody (A01)

Ref: AB-H00010312-A01
TCIRG1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TCIRG1.
Información adicional
Size 50 uL
Gene Name TCIRG1
Gene Alias ATP6N1C|ATP6V0A3|Atp6i|OC-116kDa|OC116|OPTB1|Stv1|TIRC7|Vph1|a3
Gene Description T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq QLHQLQLHAAVLRQGHEPQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAPALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TCIRG1 (AAH18133, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10312

Enviar un mensaje


TCIRG1 polyclonal antibody (A01)

TCIRG1 polyclonal antibody (A01)