ZNF267 polyclonal antibody (A01)
  • ZNF267 polyclonal antibody (A01)

ZNF267 polyclonal antibody (A01)

Ref: AB-H00010308-A01
ZNF267 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ZNF267.
Información adicional
Size 50 uL
Gene Name ZNF267
Gene Alias HZF2
Gene Description zinc finger protein 267
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KTFKYDQFDESSVESLFHQQILSSCAKSYNFDQYRKVFTHSSLLNQQEEIDIWGKHHIYDKTSVLFRQVSTLNSYRNVFIGEKNYHCNNSEKTLNQSSS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNF267 (NP_003405, 132 a.a. ~ 230 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10308

Enviar un mensaje


ZNF267 polyclonal antibody (A01)

ZNF267 polyclonal antibody (A01)