DLEU1 monoclonal antibody (M02), clone 2C2
  • DLEU1 monoclonal antibody (M02), clone 2C2

DLEU1 monoclonal antibody (M02), clone 2C2

Ref: AB-H00010301-M02
DLEU1 monoclonal antibody (M02), clone 2C2

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant DLEU1.
Información adicional
Size 100 ug
Gene Name DLEU1
Gene Alias BCMS|DLB1|DLEU2|LEU1|LEU2|MGC22430|NCRNA00021|XTP6
Gene Description deleted in lymphocytic leukemia 1 (non-protein coding)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MRPCIWIHVHLKPPCRLVELLPFSSALQGLSHLSLGTTLPVILPERNEEQNLQELSHNADKYQMGDCCKEEIDDSIFY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DLEU1 (AAH20692, 1 a.a. ~ 78 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10301
Clone Number 2C2
Iso type IgG1 Kappa

Enviar un mensaje


DLEU1 monoclonal antibody (M02), clone 2C2

DLEU1 monoclonal antibody (M02), clone 2C2