MARCH6 monoclonal antibody (M05), clone 1A5
  • MARCH6 monoclonal antibody (M05), clone 1A5

MARCH6 monoclonal antibody (M05), clone 1A5

Ref: AB-H00010299-M05
MARCH6 monoclonal antibody (M05), clone 1A5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MARCH6.
Información adicional
Size 100 ug
Gene Name MARCH6
Gene Alias KIAA0597|MARCH-VI|RNF176|TEB4
Gene Description membrane-associated ring finger (C3HC4) 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DTAEEDICRVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSRKEYCELCKHRFAFTPIYSPDMPSRLPIQDIFAGLVTSIGTAIR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MARCH6 (NP_005876, 2 a.a. ~ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10299
Clone Number 1A5
Iso type IgG2b Kappa

Enviar un mensaje


MARCH6 monoclonal antibody (M05), clone 1A5

MARCH6 monoclonal antibody (M05), clone 1A5