MARCH6 monoclonal antibody (M02), clone 2F7
  • MARCH6 monoclonal antibody (M02), clone 2F7

MARCH6 monoclonal antibody (M02), clone 2F7

Ref: AB-H00010299-M02
MARCH6 monoclonal antibody (M02), clone 2F7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MARCH6.
Información adicional
Size 100 ug
Gene Name MARCH6
Gene Alias KIAA0597|MARCH-VI|RNF176|TEB4
Gene Description membrane-associated ring finger (C3HC4) 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DTAEEDICRVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSRKEYCELCKHRFAFTPIYSPDMPSRLPIQDIFAGLVTSIGTAIR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MARCH6 (NP_005876, 2 a.a. ~ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10299
Clone Number 2F7
Iso type IgG2a Kappa

Enviar un mensaje


MARCH6 monoclonal antibody (M02), clone 2F7

MARCH6 monoclonal antibody (M02), clone 2F7