BCKDK polyclonal antibody (A01)
  • BCKDK polyclonal antibody (A01)

BCKDK polyclonal antibody (A01)

Ref: AB-H00010295-A01
BCKDK polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BCKDK.
Información adicional
Size 50 uL
Gene Name BCKDK
Gene Alias -
Gene Description branched chain ketoacid dehydrogenase kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq STSATDTHHVEMARERSKTVTSFYNQSAIDAAAEKPSVRLTPTMMLYAGRSQDGSHLLKSARYLQQELPVRIAHRIKGFRCLPFIIGCNP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BCKDK (AAH07363, 31 a.a. ~ 120 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10295

Enviar un mensaje


BCKDK polyclonal antibody (A01)

BCKDK polyclonal antibody (A01)