TRAIP monoclonal antibody (M01), clone 2E7
  • TRAIP monoclonal antibody (M01), clone 2E7

TRAIP monoclonal antibody (M01), clone 2E7

Ref: AB-H00010293-M01
TRAIP monoclonal antibody (M01), clone 2E7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TRAIP.
Información adicional
Size 100 ug
Gene Name TRAIP
Gene Alias RNF206|TRIP
Gene Description TRAF interacting protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GQSCAGEPDEELVGAFPIFVRNAILGQKQPKRPRSESSCSKDVVRTGFDGLGGRTKFIQPTDTVMIRPLPVKPKTKVKQRVRVKTVPSLFQAKLDTFLWS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRAIP (NP_005870, 370 a.a. ~ 469 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10293
Clone Number 2E7
Iso type IgG2a Kappa

Enviar un mensaje


TRAIP monoclonal antibody (M01), clone 2E7

TRAIP monoclonal antibody (M01), clone 2E7