SF3A1 polyclonal antibody (A01)
  • SF3A1 polyclonal antibody (A01)

SF3A1 polyclonal antibody (A01)

Ref: AB-H00010291-A01
SF3A1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SF3A1.
Información adicional
Size 50 uL
Gene Name SF3A1
Gene Alias PRP21|PRPF21|SAP114|SF3A120
Gene Description splicing factor 3a, subunit 1, 120kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SF3A1 (NP_005868, 140 a.a. ~ 227 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10291

Enviar un mensaje


SF3A1 polyclonal antibody (A01)

SF3A1 polyclonal antibody (A01)