APEG1 monoclonal antibody (M01), clone 2C2-2C7
  • APEG1 monoclonal antibody (M01), clone 2C2-2C7

APEG1 monoclonal antibody (M01), clone 2C2-2C7

Ref: AB-H00010290-M01
APEG1 monoclonal antibody (M01), clone 2C2-2C7

Información del producto

Mouse monoclonal antibody raised against a full length recombinant APEG1.
Información adicional
Size 100 ug
Gene Name SPEG
Gene Alias APEG1|BPEG|KIAA1297|MGC12676|SPEGalpha|SPEGbeta
Gene Description SPEG complex locus
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRGE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen APEG1 (AAH06346, 1 a.a. ~ 113 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10290
Clone Number 2C2-2C7
Iso type IgG1 Kappa

Enviar un mensaje


APEG1 monoclonal antibody (M01), clone 2C2-2C7

APEG1 monoclonal antibody (M01), clone 2C2-2C7