SPEG purified MaxPab rabbit polyclonal antibody (D01P)
  • SPEG purified MaxPab rabbit polyclonal antibody (D01P)

SPEG purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010290-D01P
SPEG purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SPEG protein.
Información adicional
Size 100 ug
Gene Name SPEG
Gene Alias APEG1|BPEG|KIAA1297|MGC12676|SPEGalpha|SPEGbeta
Gene Description SPEG complex locus
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRGE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SPEG (AAH06346.1, 1 a.a. ~ 113 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10290

Enviar un mensaje


SPEG purified MaxPab rabbit polyclonal antibody (D01P)

SPEG purified MaxPab rabbit polyclonal antibody (D01P)