SAP18 purified MaxPab mouse polyclonal antibody (B01P)
  • SAP18 purified MaxPab mouse polyclonal antibody (B01P)

SAP18 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010284-B01P
SAP18 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SAP18 protein.
Información adicional
Size 50 ug
Gene Name SAP18
Gene Alias 2HOR0202|MGC27131|SAP18P
Gene Description Sin3A-associated protein, 18kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPPSGRMRPY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SAP18 (NP_005861.1, 1 a.a. ~ 153 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10284

Enviar un mensaje


SAP18 purified MaxPab mouse polyclonal antibody (B01P)

SAP18 purified MaxPab mouse polyclonal antibody (B01P)