STAG1 polyclonal antibody (A01)
  • STAG1 polyclonal antibody (A01)

STAG1 polyclonal antibody (A01)

Ref: AB-H00010274-A01
STAG1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant STAG1.
Información adicional
Size 50 uL
Gene Name STAG1
Gene Alias DKFZp781D1416|SA1
Gene Description stromal antigen 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq LPAPQLTSTVLRENSRPMGDQIQEPESEHGSEPDFLHNRGLMEEDAEPIFEDVMMSSRSQLEDMNEEFEDTMVIDLPPSRNRRERAELRPDFFDSAAIIEDDSGFGMPMF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STAG1 (AAH64699, 1112 a.a. ~ 1221 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10274

Enviar un mensaje


STAG1 polyclonal antibody (A01)

STAG1 polyclonal antibody (A01)