RAMP3 purified MaxPab mouse polyclonal antibody (B01P)
  • RAMP3 purified MaxPab mouse polyclonal antibody (B01P)

RAMP3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010268-B01P
RAMP3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RAMP3 protein.
Información adicional
Size 50 ug
Gene Name RAMP3
Gene Alias -
Gene Description receptor (G protein-coupled) activity modifying protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RAMP3 (NP_005847.1, 1 a.a. ~ 148 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10268

Enviar un mensaje


RAMP3 purified MaxPab mouse polyclonal antibody (B01P)

RAMP3 purified MaxPab mouse polyclonal antibody (B01P)