RAMP1 polyclonal antibody (A01)
  • RAMP1 polyclonal antibody (A01)

RAMP1 polyclonal antibody (A01)

Ref: AB-H00010267-A01
RAMP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RAMP1.
Información adicional
Size 50 uL
Gene Name RAMP1
Gene Alias -
Gene Description receptor (G protein-coupled) activity modifying protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq CQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAMP1 (NP_005846, 27 a.a. ~ 117 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10267

Enviar un mensaje


RAMP1 polyclonal antibody (A01)

RAMP1 polyclonal antibody (A01)