RAMP2 polyclonal antibody (A01)
  • RAMP2 polyclonal antibody (A01)

RAMP2 polyclonal antibody (A01)

Ref: AB-H00010266-A01
RAMP2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RAMP2.
Información adicional
Size 50 uL
Gene Name RAMP2
Gene Alias -
Gene Description receptor (G protein-coupled) activity modifying protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq LPTTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSDPPED
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAMP2 (NP_005845, 45 a.a. ~ 144 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10266

Enviar un mensaje


RAMP2 polyclonal antibody (A01)

RAMP2 polyclonal antibody (A01)