CNKSR1 purified MaxPab mouse polyclonal antibody (B01P)
  • CNKSR1 purified MaxPab mouse polyclonal antibody (B01P)

CNKSR1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010256-B01P
CNKSR1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CNKSR1 protein.
Información adicional
Size 50 ug
Gene Name CNKSR1
Gene Alias CNK|CNK1|KSR
Gene Description connector enhancer of kinase suppressor of Ras 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEPVETWTPGKVATWLRGLDDSLQDYPFEDWQLPGKNLLQLCPQSLEALAVRSLGHQELILGGVEQLQALSSRLQTENLQSLTEGLLGATHDFQSIVQGCLGDCAKTPIDVLCAAVELLHEADALLFWLSRYLFSHLNDFSACQEIRDLLEELSQVLHEDGPAAEKEGTVLRICSHVAGICHNILVCCPKELLEQKAVLEQVQLDSPLGLEIHTTSNCQHFVSQVDTQVPTDSRLQIQPGDEVVQINEQVVVREE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CNKSR1 (AAH12797.1, 1 a.a. ~ 720 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10256

Enviar un mensaje


CNKSR1 purified MaxPab mouse polyclonal antibody (B01P)

CNKSR1 purified MaxPab mouse polyclonal antibody (B01P)