POP7 monoclonal antibody (M13), clone 3F12
  • POP7 monoclonal antibody (M13), clone 3F12

POP7 monoclonal antibody (M13), clone 3F12

Ref: AB-H00010248-M13
POP7 monoclonal antibody (M13), clone 3F12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant POP7.
Información adicional
Size 100 ug
Gene Name POP7
Gene Alias 0610037N12Rik|RPP2|RPP20
Gene Description processing of precursor 7, ribonuclease P/MRP subunit (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POP7 (NP_005828.1, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10248
Clone Number 3F12
Iso type IgG1 Kappa

Enviar un mensaje


POP7 monoclonal antibody (M13), clone 3F12

POP7 monoclonal antibody (M13), clone 3F12