CALCOCO2 purified MaxPab rabbit polyclonal antibody (D01P)
  • CALCOCO2 purified MaxPab rabbit polyclonal antibody (D01P)

CALCOCO2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010241-D01P
CALCOCO2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CALCOCO2 protein.
Información adicional
Size 100 ug
Gene Name CALCOCO2
Gene Alias MGC17318|NDP52
Gene Description calcium binding and coiled-coil domain 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFRVGWKTTREYYTFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDYWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CALCOCO2 (NP_005822.1, 1 a.a. ~ 446 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10241

Enviar un mensaje


CALCOCO2 purified MaxPab rabbit polyclonal antibody (D01P)

CALCOCO2 purified MaxPab rabbit polyclonal antibody (D01P)