TRIB1 monoclonal antibody (M01), clone 4A10
  • TRIB1 monoclonal antibody (M01), clone 4A10

TRIB1 monoclonal antibody (M01), clone 4A10

Ref: AB-H00010221-M01
TRIB1 monoclonal antibody (M01), clone 4A10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TRIB1.
Información adicional
Size 100 ug
Gene Name TRIB1
Gene Alias C8FW|GIG2|SKIP1
Gene Description tribbles homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq IADYLLLPLAEREHVSRALCIHTGRELRCKVFPIKHYQDKIRPYIQLPSHSNITGIVEVILGETKAYVFFEKDFGDMHSYVRSRKRLREEEAARLFKQIVS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRIB1 (NP_079471, 91 a.a. ~ 191 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10221
Clone Number 4A10
Iso type IgG1 Kappa

Enviar un mensaje


TRIB1 monoclonal antibody (M01), clone 4A10

TRIB1 monoclonal antibody (M01), clone 4A10