ANGPTL7 purified MaxPab mouse polyclonal antibody (B01P)
  • ANGPTL7 purified MaxPab mouse polyclonal antibody (B01P)

ANGPTL7 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010218-B01P
ANGPTL7 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ANGPTL7 protein.
Información adicional
Size 50 ug
Gene Name ANGPTL7
Gene Alias AngX|CDT6|RP4-647M16.2|dJ647M16.1
Gene Description angiopoietin-like 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MLKKPLSAVTWLCIFIVAFVSHPAWLQKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ANGPTL7 (NP_066969, 1 a.a. ~ 346 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10218

Enviar un mensaje


ANGPTL7 purified MaxPab mouse polyclonal antibody (B01P)

ANGPTL7 purified MaxPab mouse polyclonal antibody (B01P)