PRG4 monoclonal antibody (M02), clone 1D5
  • PRG4 monoclonal antibody (M02), clone 1D5

PRG4 monoclonal antibody (M02), clone 1D5

Ref: AB-H00010216-M02
PRG4 monoclonal antibody (M02), clone 1D5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRG4.
Información adicional
Size 100 ug
Gene Name PRG4
Gene Alias CACP|FLJ32635|HAPO|JCAP|MSF|SZP|bG174L6.2
Gene Description proteoglycan 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ERAIGPSQTHTIRIQYSPARLAYQDKGVLHNEVKVSILWRGLPNVVTSAISLPNIRKPDGYDYYAFSKDQYYNIDVPSRTARAITTRSGQTLSKVWYNCP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRG4 (NP_005798, 1305 a.a. ~ 1404 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10216
Clone Number 1D5
Iso type IgG2a Kappa

Enviar un mensaje


PRG4 monoclonal antibody (M02), clone 1D5

PRG4 monoclonal antibody (M02), clone 1D5