SSX3 purified MaxPab mouse polyclonal antibody (B01P)
  • SSX3 purified MaxPab mouse polyclonal antibody (B01P)

SSX3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010214-B01P
SSX3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SSX3 protein.
Información adicional
Size 50 ug
Gene Name SSX3
Gene Alias MGC119054|MGC14495
Gene Description synovial sarcoma, X breakpoint 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNGDDTFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKVSEKIVYVYMKRKYEAMTKLGFKAILPSFMRNKRVTDFQGNDFDNDPNRGNQVQRPQMTFGRLQGIFPKIMPKKPAEEGNVSKEVPEASGPQNDGKQLCPPGKPTTSEKINMISGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SSX3 (NP_066294.1, 1 a.a. ~ 188 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10214

Enviar un mensaje


SSX3 purified MaxPab mouse polyclonal antibody (B01P)

SSX3 purified MaxPab mouse polyclonal antibody (B01P)