FLOT1 purified MaxPab rabbit polyclonal antibody (D01P)
  • FLOT1 purified MaxPab rabbit polyclonal antibody (D01P)

FLOT1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010211-D01P
FLOT1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FLOT1 protein.
Información adicional
Size 100 ug
Gene Name FLOT1
Gene Alias -
Gene Description flotillin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MFFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FLOT1 (NP_005794.1, 1 a.a. ~ 427 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10211

Enviar un mensaje


FLOT1 purified MaxPab rabbit polyclonal antibody (D01P)

FLOT1 purified MaxPab rabbit polyclonal antibody (D01P)