TOPORS polyclonal antibody (A01)
  • TOPORS polyclonal antibody (A01)

TOPORS polyclonal antibody (A01)

Ref: AB-H00010210-A01
TOPORS polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TOPORS.
Información adicional
Size 50 uL
Gene Name TOPORS
Gene Alias LUN|P53BP3|RP31|TP53BPL
Gene Description topoisomerase I binding, arginine/serine-rich
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TOPORS (NP_005793, 98 a.a. ~ 205 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10210

Enviar un mensaje


TOPORS polyclonal antibody (A01)

TOPORS polyclonal antibody (A01)