TRIM13 monoclonal antibody (M01), clone 2A11
  • TRIM13 monoclonal antibody (M01), clone 2A11

TRIM13 monoclonal antibody (M01), clone 2A11

Ref: AB-H00010206-M01
TRIM13 monoclonal antibody (M01), clone 2A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TRIM13.
Información adicional
Size 100 ug
Gene Name TRIM13
Gene Alias CAR|DLEU5|LEU5|RFP2|RNF77
Gene Description tripartite motif-containing 13
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGSVRNSLWRPAPFKCPTCRKETSATGINSLQVNYSLKGIVEKYNKIKISPKMPVCKGHLGQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRIM13 (NP_005789, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10206
Clone Number 2A11
Iso type IgG2a lambda

Enviar un mensaje


TRIM13 monoclonal antibody (M01), clone 2A11

TRIM13 monoclonal antibody (M01), clone 2A11