MPZL2 monoclonal antibody (M06), clone 2E10
  • MPZL2 monoclonal antibody (M06), clone 2E10

MPZL2 monoclonal antibody (M06), clone 2E10

Ref: AB-H00010205-M06
MPZL2 monoclonal antibody (M06), clone 2E10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MPZL2.
Información adicional
Size 100 ug
Gene Name MPZL2
Gene Alias EVA|EVA1
Gene Description myelin protein zero-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,IF
Immunogen Prot. Seq VEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MPZL2 (NP_005788.1, 27 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10205
Clone Number 2E10
Iso type IgG2a Kappa

Enviar un mensaje


MPZL2 monoclonal antibody (M06), clone 2E10

MPZL2 monoclonal antibody (M06), clone 2E10