MPZL2 purified MaxPab rabbit polyclonal antibody (D01P)
  • MPZL2 purified MaxPab rabbit polyclonal antibody (D01P)

MPZL2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010205-D01P
MPZL2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MPZL2 protein.
Información adicional
Size 100 ug
Gene Name MPZL2
Gene Alias EVA|EVA1
Gene Description myelin protein zero-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MYGKSSTRAVLLLLGIQLTALWPIAAVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIGEIRLSVVHTVRFSEIHFLALAIGSACALMIIIVIVVVLFQHYRKKRWAERAHKVVEIKSKEEERLNQEKKVSVYLEDTD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MPZL2 (NP_005788.1, 1 a.a. ~ 215 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10205

Enviar un mensaje


MPZL2 purified MaxPab rabbit polyclonal antibody (D01P)

MPZL2 purified MaxPab rabbit polyclonal antibody (D01P)