MPZL2 MaxPab rabbit polyclonal antibody (D01)
  • MPZL2 MaxPab rabbit polyclonal antibody (D01)

MPZL2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00010205-D01
MPZL2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MPZL2 protein.
Información adicional
Size 100 uL
Gene Name MPZL2
Gene Alias EVA|EVA1
Gene Description myelin protein zero-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MYGKSSTRAVLLLLGIQLTALWPIAAVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIGEIRLSVVHTVRFSEIHFLALAIGSACALMIIIVIVVVLFQHYRKKRWAERAHKVVEIKSKEEERLNQEKKVSVYLEDTD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MPZL2 (NP_005788.1, 1 a.a. ~ 215 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 10205

Enviar un mensaje


MPZL2 MaxPab rabbit polyclonal antibody (D01)

MPZL2 MaxPab rabbit polyclonal antibody (D01)