DHRS2 monoclonal antibody (M03), clone 1F10
  • DHRS2 monoclonal antibody (M03), clone 1F10

DHRS2 monoclonal antibody (M03), clone 1F10

Ref: AB-H00010202-M03
DHRS2 monoclonal antibody (M03), clone 1F10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DHRS2.
Información adicional
Size 100 ug
Gene Name DHRS2
Gene Alias HEP27|SDR25C1
Gene Description dehydrogenase/reductase (SDR family) member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GFMGMSLSGRTSRNIISCRGLGSQRTVQESCPSCALQMPATSTGRTLRWQATPLGSERSGGGCVAVVPGPGA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DHRS2 (NP_878912.1, 229 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10202
Clone Number 1F10
Iso type IgG2a Kappa

Enviar un mensaje


DHRS2 monoclonal antibody (M03), clone 1F10

DHRS2 monoclonal antibody (M03), clone 1F10